Mechanism
Replaces or supplements endogenous insulin to control blood glucose.
TechnicalBinds the insulin receptor (RTK), driving GLUT4 translocation, glycogen synthesis, and lipogenesis.A-chain GIVEQCCTSICSLYQLENYCN · B-chain FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Reported uses by species
| Species | Indication | Tier | Honest evidence note |
|---|---|---|---|
| Dogs | Diabetes mellitus | Standard-of-care | First-line standard of care. |
| Cats | Diabetes mellitus | Standard-of-care | First-line standard of care; long-acting analogs preferred. |
Suggested starting protocol
Starting points only — clinical judgment required. Dosing unlocks for verified veterinary accounts.
Professional-use acknowledgment
Confirm you are a veterinary professional
Dosing tables on monographs are for licensed veterinary professionals using independent clinical judgment.
- • I am a licensed veterinary professional accessing this content for clinical use.
- • I will exercise independent clinical judgment for every patient.
- • I understand evidence labels reflect the current state of published research.
Monitoring, contraindications & do-not-use-if
Active hypoglycemia. Adjust during illness, anesthesia, or steroid changes. Owner training on glucagon for hypoglycemia recommended.
The evidence
- Peptides for Veterinary Applications — PeptideJournalPeptideJournal
- Peptides in Veterinary Medicine — BachemBachem